PTM Viewer PTM Viewer

AT4G36040.1

Arabidopsis thaliana [ath]

Chaperone DnaJ-domain superfamily protein

No PTMs currently found

PLAZA: AT4G36040
Gene Family: HOM05D001140
Other Names: DJC23,DNA J protein C23; DnaJ11; J11

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 161

MLSSSPTSFTHPFLSSSPPLSPISPPSRTARISPPLVSASCSYTYTEDSPRLHQIPRRLTTVPASLYDVLEVPLGATSQDIKSAYRRLARICHPDVAGTDRTSSSSADEFMKIHAAYCTLSDPEKRSVYDRRMLRRSRPLTVGTSGLGSYVGRNWETDQCW

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR001623 64 133
Molecule Processing
Show Type From To
Transit Peptide 1 36

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here